PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.KL6KV
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family HD-ZIP
Protein Properties Length: 282aa    MW: 31676.4 Da    PI: 7.4745
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.KL6KVgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.11.4e-18126180256
                  T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  rk+ +++k+q  +Lee F+++++++ +++  LAk+lgL  rqV vWFqNrRa+ k
  Aradu.KL6KV 126 RKKLRLSKDQSAVLEESFKEHNTLNPKQKLALAKQLGLRARQVEVWFQNRRARTK 180
                  788899***********************************************98 PP

2HD-ZIP_I/II126.99e-41126215191
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                  +kk+rlsk+q+++LEesF+e+++L+p++K +la++Lgl++rqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+kev+eLr +l
  Aradu.KL6KV 126 RKKLRLSKDQSAVLEESFKEHNTLNPKQKLALAKQLGLRARQVEVWFQNRRARTKLKQTEVDCEFLKRCCENLTEENRRLQKEVQELR-AL 215
                  69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046185.9E-22396IPR006712HD-ZIP protein, N-terminal
SuperFamilySSF466893.25E-18113183IPR009057Homeodomain-like
PROSITE profilePS5007117.313122182IPR001356Homeobox domain
SMARTSM003895.4E-16124186IPR001356Homeobox domain
PfamPF000464.6E-16126180IPR001356Homeobox domain
CDDcd000864.17E-15126183No hitNo description
Gene3DG3DSA:1.10.10.601.9E-17126180IPR009057Homeodomain-like
PRINTSPR000312.3E-5153162IPR000047Helix-turn-helix motif
PROSITE patternPS000270157180IPR017970Homeobox, conserved site
PRINTSPR000312.3E-5162178IPR000047Helix-turn-helix motif
SMARTSM003404.2E-27182225IPR003106Leucine zipper, homeobox-associated
PfamPF021832.1E-11182216IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009641Biological Processshade avoidance
GO:0009734Biological Processauxin-activated signaling pathway
GO:0009826Biological Processunidimensional cell growth
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MTMENQDLGL TLSLSFPQQQ LNLIPSPYKT PSWNNQPFNS SDNRDSETCR GSAEGGSFLL  60
RGIDVNSLPS GVDCEDDAGV SSPNSTVSSV SGKRSSEREQ NNGEDHDTER ASSRGISDEE  120
DGETSRKKLR LSKDQSAVLE ESFKEHNTLN PKQKLALAKQ LGLRARQVEV WFQNRRARTK  180
LKQTEVDCEF LKRCCENLTE ENRRLQKEVQ ELRALKLSPQ FYMQMSPPTT LTMCPSCERV  240
AVPPSAVDPA TRHHQMPQPH HHTRPIPIGP WAAAPPVFRP RS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1124130SRKKLRL
2174182RRARTKLKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00550DAPTransfer from AT5G47370Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015963622.10.0PREDICTED: homeobox-leucine zipper protein HAT4
SwissprotP466011e-106HAT2_ARATH; Homeobox-leucine zipper protein HAT2
TrEMBLV7CEB51e-143V7CEB5_PHAVU; Uncharacterized protein
STRINGGLYMA11G03850.11e-138(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF123934105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.19e-85homeobox protein 2